PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G278100.1.p
Common NameGLYMA_18G278100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 353aa    MW: 38986.5 Da    PI: 6.2653
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G278100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.31.1e-061351439
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...Htv 39
                         r+C+++ + + + fC++   +lC++C +  H +   H++
  Glyma.18G278100.1.p 13 RMCDTCRSVPSTVFCRSHTAFLCATCDTRLHVSltwHER 51
                         78**************************99977777875 PP

2zf-B_box28.72.8e-095297342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          ++C+ +e+ ++ + C+ +   lC++C   +H        H +vp+
  Glyma.18G278100.1.p 52 VWVCEACERAPAAFLCKADAASLCASCDADIHAAnplasrHHRVPI 97
                         689*****************************66889999777775 PP

3CCT68.22.2e-23283326144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Glyma.18G278100.1.p 283 REARVLRYREKKKMRKFEKTIRYASRKAYAETRPRIKGRFAKRT 326
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.151047IPR000315B-box-type zinc finger
PROSITE profilePS501199.6271054IPR000315B-box-type zinc finger
CDDcd000211.36E-51354No hitNo description
SMARTSM003361.5E-135097IPR000315B-box-type zinc finger
PROSITE profilePS5011910.9645097IPR000315B-box-type zinc finger
PfamPF006435.7E-75197IPR000315B-box-type zinc finger
CDDcd000213.84E-85397No hitNo description
PROSITE profilePS5101716.539283325IPR010402CCT domain
PfamPF062033.3E-17283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MLEGQATTPT WPRMCDTCRS VPSTVFCRSH TAFLCATCDT RLHVSLTWHE RVWVCEACER  60
APAAFLCKAD AASLCASCDA DIHAANPLAS RHHRVPILPI AAANNNNNDD DDVADVDDED  120
ETASWLLLNP IKSATVPNTN NNNNNNGFLY NGEVDEYLDL VDNCNSCGDN NHFASAAATT  180
DHYAQHQHFA GVSQKSYAGD SVVPVQQHQH FQLGLEFDNS KPAFSYNGSV SQSVSVSSMD  240
IGVVPESPMR DVSIAHTRPP KGTIDLFSGP PIQVPSHFSP MDREARVLRY REKKKMRKFE  300
KTIRYASRKA YAETRPRIKG RFAKRTDVEA EVDQMFSTTL ITEVGYGIVP SF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290296REKKKMR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.558930.0cotyledon| flower| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3718980.0DQ371898.1 Glycine max zinc finger protein CONSTANS-LIKE 2 (COL2c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235843.10.0zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-119COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLI1N4U70.0I1N4U7_SOYBN; Uncharacterized protein
STRINGGLYMA18G51320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-94CONSTANS-like 2